Loading...
Statistics

KAEF
www.fact260.fr/
Olivier LEGRAND a.k.a. KAEF Graphic Designer Contact: kaef[at]Fact260[dot]fr

Fact260.fr

Conversion Technology Metas Server
Fact260.fr is hosted in United States / New York . Fact260.fr doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 7. First javascripts: Pre_tumblelog.js, Jquery.min.js, Swfaddress.js, Number of used analytics tools: 0. Its server type is: nginx. Its CMS is: Tumblr.

Technologies in use by Fact260.fr

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Iframe
  • Javascript
  • jQuery Cookie

Javascripts

Number of occurences: 7
  • pre_tumblelog.js
  • jquery.min.js
  • swfaddress.js
  • jquery.cookie.js
  • magic.js
  • tumblelog_post_message_queue.js
  • index.build.js

Content Management System

Number of occurences: 1
  • Tumblr

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Fact260.fr

Missing HTTPS protocol.

    Meta - Fact260.fr

    Number of occurences: 25
    • Name: description
      Content: Olivier LEGRAND a.k.a. KAEF Graphic Designer Contact: kaef[at]Fact260[dot]fr
    • Name:
      Content:
    • Name: color:Page BG
      Content: #FFF
    • Name: color:Video BG
      Content: #000000
    • Name: color:Regular and Quote BG
      Content: #08bcc3
    • Name: color:Chat BG
      Content: #f392dd
    • Name: color:Link BG
      Content: #a10789
    • Name: color:Audio BG
      Content: #ff4040
    • Name: text:Disqus Shortname
      Content:
    • Name: if:Show About In Nav
      Content: 1
    • Name: if:Show Following In Nav
      Content: 1
    • Name: keywords
      Content: veterans day,poppy day,remembrance day
    • Name: twitter:site
      Content: tumblr
    • Name: twitter:card
      Content: app
    • Name: twitter:description
      Content: kaef
    • Name: twitter:title
      Content: kaef
    • Name: twitter:app:name:iphone
      Content: Tumblr
    • Name: twitter:app:name:ipad
      Content: Tumblr
    • Name: twitter:app:name:googleplay
      Content: Tumblr
    • Name: twitter:app:id:iphone
      Content: 305343404
    • Name: twitter:app:id:ipad
      Content: 305343404
    • Name: twitter:app:id:googleplay
      Content: com.tumblr
    • Name: twitter:app:url:iphone
      Content: tumblr://x-callback-url/blog?blogName=kaef&referrer=twitter-cards
    • Name: twitter:app:url:ipad
      Content: tumblr://x-callback-url/blog?blogName=kaef&referrer=twitter-cards
    • Name: twitter:app:url:googleplay
      Content: tumblr://x-callback-url/blog?blogName=kaef&referrer=twitter-cards

    Server / Hosting

    • IP: 66.6.44.4
    • Latitude: 40.74
    • Longitude: -73.98
    • Country: United States
    • City: New York

    Rname

    • ns11.1and1.fr
    • ns12.1and1.fr
    • mx01.1and1.fr
    • mx00.1and1.fr

    Target

    • hostmaster.1and1.fr

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 18 Apr 2016 09:21:58 GMT Content-Type: text/html Connection: keep-alive Set-Cookie: tmgioct=5714a7361ab9840387378080; expires=Thu, 16-Apr-2026 09:21:58 GMT; Max-Age=315360000; path=/; httponly P3P: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy" Cache-Control: public Pragma: Location: http://www.fact260.fr/#_=_ X-UA-Compatible: IE=Edge,chrome=1 HTTP/1.1 200 OK Server: nginx Date: Mon, 18 Apr 2016 09:21:58 GMT Content-Type: text/html; charset=utf-8 Connection: keep-alive Vary: Accept-Encoding Vary: Accept-Encoding Set-Cookie: tmgioct=5714a73658f3640469709910; expires=Thu, 16-Apr-2026 09:21:58 GMT; Max-Age=315360000; path=/; httponly P3P: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy" X-Tumblr-User: kaef X-Tumblr-Pixel-0: https://px.srvcs.tumblr.com/impixu?T=1460971318&J=eyJ0eXBlIjoidXJsIiwidXJsIjoiaHR0cDpcL1wvd3d3LmZhY3QyNjAuZnJcLyIsInJlcXR5cGUiOjAsInJvdXRlIjoiXC8ifQ==&U=KBLPNNGJMC&K=e850bef9ae29dacb7a1ff8ec030c5dc5ae8017ec29bce270281615bf3a44c2bf--https://px.srvcs.tumblr.com/impixu?T=1460971318&J=eyJ0eXBlIjoicG9zdCIsInVybCI6Imh0dHA6XC9cL3d3dy5mYWN0MjYwLmZyXC8iLCJyZXF0eXBlIjowLCJyb3V0ZSI6IlwvIiwicG9zdHMiOlt7InBvc3RpZCI6IjExODcwMTQxNzU2NyIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjExNDA1 X-Tumblr-Pixel-1: NDcwMTM0MiIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjEwNDI0MjQwODU2NyIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjEwMTc0Njc4NTI1NyIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjgzMDAwOTEwOTgzIiwiYmxvZ2lkIjoiMTkxNDg3NyIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNzM2MjI0NTEwMDEiLCJibG9naWQiOiIxOTE0ODc3Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI3MzMwNTUwNjAxMSIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjczMjA3NDYzNzk3IiwiYmxvZ2lkIjoiMTkxNDg3NyIsIn X-Tumblr-Pixel-2: NvdXJjZSI6MzN9LHsicG9zdGlkIjoiNjYwOTk2NDI0NzAiLCJibG9naWQiOiIxOTE0ODc3Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI2NTAzNzI2MzMxNSIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjY0MDA3MzEzNDUxIiwiYmxvZ2lkIjoiMTkxNDg3NyIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNjIwNjY3NzU3NTMiLCJibG9naWQiOiIxOTE0ODc3Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI2MjA2NjczNDY0NiIsImJsb2dpZCI6IjE5MTQ4NzciLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6IjUyNzg3NTUxMDM0IiwiYmxvZ2lkIjoiMTkxNDg3NyIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNTA0OTY0NzA1 X-Tumblr-Pixel-3: OTQiLCJibG9naWQiOiIxOTE0ODc3Iiwic291cmNlIjozM31dfQ==&U=LAKIDECGIE&K=a493a240745494d3e746e63399bdda3b4694b4c5133c9f948c47a93cf17b6d70 X-Tumblr-Pixel: 4 Link: ; rel=icon X-UA-Compatible: IE=Edge,chrome=1

    DNS

    host: fact260.fr
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 66.6.44.4
    host: fact260.fr
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns11.1and1.fr
    host: fact260.fr
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns12.1and1.fr
    host: fact260.fr
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns11.1and1.fr
    5. rname: hostmaster.1and1.fr
    6. serial: 2015082301
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: fact260.fr
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.1and1.fr
    host: fact260.fr
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.1and1.fr

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.act260.fr, www.fqact260.fr, www.qact260.fr, www.fact260.fr, www.act260.fr, www.faact260.fr, www.aact260.fr, www.fyact260.fr, www.yact260.fr, www.ftact260.fr, www.tact260.fr, www.fgact260.fr, www.gact260.fr, www.fbact260.fr, www.bact260.fr, www.fwact260.fr, www.wact260.fr, www.fsact260.fr, www.sact260.fr, www.fdact260.fr, www.dact260.fr, www.fract260.fr, www.ract260.fr, www.f3act260.fr, www.3act260.fr, www.f4act260.fr, www.4act260.fr, www.fct260.fr, www.faoct260.fr, www.foct260.fr, www.fapct260.fr, www.fpct260.fr, www.fa9ct260.fr, www.f9ct260.fr, www.fact260.fr, www.fct260.fr, www.faict260.fr, www.fict260.fr, www.fauct260.fr, www.fuct260.fr, www.fat260.fr, www.facdt260.fr, www.fadt260.fr, www.facrt260.fr, www.fart260.fr, www.factt260.fr, www.fatt260.fr, www.facvt260.fr, www.favt260.fr, www.facft260.fr, www.faft260.fr, www.facgt260.fr, www.fagt260.fr, www.facht260.fr, www.faht260.fr, www.facnt260.fr, www.fant260.fr, www.facmt260.fr, www.famt260.fr, www.facjt260.fr, www.fajt260.fr, www.fac260.fr, www.factq260.fr, www.facq260.fr, www.facta260.fr, www.faca260.fr, www.fact 260.fr, www.fac 260.fr, www.factw260.fr, www.facw260.fr, www.facte260.fr, www.face260.fr, www.factz260.fr, www.facz260.fr, www.factx260.fr, www.facx260.fr, www.factc260.fr, www.facc260.fr, www.fact60.fr, www.fact2060.fr, www.fact060.fr, www.fact2q60.fr, www.factq60.fr, www.fact2w60.fr, www.factw60.fr, www.fact20.fr, www.fact26r0.fr, www.fact2r0.fr, www.fact26t0.fr, www.fact2t0.fr, www.fact26z0.fr, www.fact2z0.fr, www.fact26y0.fr, www.fact2y0.fr, www.fact2640.fr, www.fact240.fr, www.fact26.fr, www.fact260i.fr, www.fact26i.fr, www.fact260o.fr, www.fact26o.fr, www.fact260p.fr, www.fact26p.fr, www.fact2608.fr, www.fact268.fr, www.fact260i.fr, www.fact26i.fr, www.fact260o.fr, www.fact26o.fr,

    Other websites we recently analyzed

    1. Event Scheduler
      Philadelphia (United States) - 208.242.14.183
      Server software:
      Technology: CSS, Html, Javascript, Google Analytics
      Number of meta tags: 1
    2. www.snbootshoes.com
      Scottsdale (United States) - 184.168.221.31
      Server software: Microsoft-IIS/7.5
      Technology: Html
    3. bharatb2b.co.in
      Noida (India) - 202.71.129.17
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Javascript, Swf Object
      Number of meta tags: 4
    4. À岩
      Shanghai (China) - 222.73.144.185
      Server software: Nginx
      Technology: CSS, Html, Iframe, Swf Object
      Number of meta tags: 1
    5. zyprian photographie | Das mobile Fotostudio – Events – Werbung – Hochzeiten
      Germany - 82.165.196.138
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    6. Trigrid Internship
      Scottsdale (United States) - 50.63.97.128
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 1
    7. christsmercychurch.com
      The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
      New York (United States) - 198.185.159.144
      Server software:
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    8. smallkitchenappliancesreview.com
      Virgin Islands, British - 208.91.197.13
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    9. Bellingham Dental Group – Dentist in Bellingham, WA - Dentist Bellingham WA with Dr. Parker Haley
      Bellingham Dentist Dr. Parker Haley leads Bellingham Dental Group, offering a range of dental services including student & emergency services. 360-734-6190
      Scottsdale (United States) - 50.62.89.138
      G Analytics ID: UA-42878548-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Google +1 Button
      Number of Javascript: 13
      Number of meta tags: 5
    10. Home
      My Joomla CMS
      Australia - 221.121.144.145
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, SuperFish, Joomla
      Number of Javascript: 15
      Number of meta tags: 3

    Check Other Websites